PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00017.1_g00146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 455aa    MW: 51887.4 Da    PI: 6.678
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00017.1_g00146.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.52.2e-083744121854
                              HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              +F++  ++yp+ +e+  LA + gLt +qV++WF N R +
  Rsa1.0_00017.1_g00146.1 374 MFQNflHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVR 412
                              5887779******************************88 PP

2BELL911.2e-29249319172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              +rq+l++kk++Ll+ll++Vd+rY+++v++++tv+s+F+a+++l++ +++t++Al++iS  +++L+++i+++i
  Rsa1.0_00017.1_g00146.1 249 QRQALEAKKTHLLDLLQMVDDRYSHCVDEIHTVVSAFHAATELDP-QLHTRFALQTISYLYKNLRERISKKI 319
                              689******************************************.***********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-43185317IPR006563POX domain
PfamPF075268.5E-28190316IPR006563POX domain
PROSITE profilePS5007110.981353416IPR001356Homeobox domain
SMARTSM003891.1E-4356420IPR001356Homeobox domain
CDDcd000863.05E-10356417No hitNo description
SuperFamilySSF466898.13E-15357425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-25359422IPR009057Homeodomain-like
PfamPF059201.5E-14373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MDNNNTFSSL DNVMTNQNHL LMDLIPSRED PTSFSTMLPW NSIRQDPLQM GGFDIFNSFL  60
TNKYLSSTPR STNVLETSFE AMAPPPPPLH HLDHFRPPYD DSSNNMWSLG ENSEFHAYPY  120
VEGVVGPSEP IISTFGEEDF PRNELSLSLA TDVSDECSGM SLCAATKYTR IPSEQASSST  180
KDVSNNVSQV IFGSKYLHSV QEILSHFATY SLNGIENNPQ CYFSSRGTES EGTNSAYENL  240
NEFLDGGSQR QALEAKKTHL LDLLQMVDDR YSHCVDEIHT VVSAFHAATE LDPQLHTRFA  300
LQTISYLYKN LRERISKKIL MMGSVLERGK EKSQEDSIFH QHCLLQQLKR KNHQIWRPQR  360
GLPEKSVSVL RTWMFQNFLH PYPKDSEKHL LAIRSGLTRS QVSNWFINAR VRLWKPMIED  420
MYAEMNKRKM SNTHLQGGNG GSVIRVPKSV MMTHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-13362419562Homeobox protein Meis2
3k2a_B1e-13362419562Homeobox protein Meis2
4xrs_A9e-14362419158Homeobox protein Meis1
4xrs_B9e-14362419158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0721740.0AY072174.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankAY0965130.0AY096513.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankX801260.0X80126.1 A.thaliana AtH1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660117.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_013660118.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487310.0ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A078BX880.0A0A078BX88_BRANA; BnaC01g05260D protein
STRINGBra011403.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM82282637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.10.0homeobox gene 1